PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna11415.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HRT-like
Protein Properties Length: 677aa    MW: 73876.5 Da    PI: 9.1006
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna11415.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like46.94.5e-15275303129
                 HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGm 29 
                              +CGv+++dG +C++ Pv+gRKRC++HKG 
  mrna11415.1-v1.0-hybrid 275 VCGVAIGDGPICRKAPVQGRKRCAAHKGI 303
                              7***************************6 PP

2HRT-like59.74.7e-19330359130
                 HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                              iCGv+ +dGs+C+r+Pv+gRKRC+eHKGmR
  mrna11415.1-v1.0-hybrid 330 ICGVAAGDGSTCRRPPVQGRKRCAEHKGMR 359
                              8***************************** PP

3HRT-like52.77.2e-17385414130
                 HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                              iCGv+ +dGs+C+ +Pv+gR RC+ HKGmR
  mrna11415.1-v1.0-hybrid 385 ICGVAAGDGSICRVPPVPGRVRCAMHKGMR 414
                              8***************************** PP

4HRT-like49.95.3e-16440469130
                 HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                              iCG++ +dGs+C ++Pv+gR RC+ HKGmR
  mrna11415.1-v1.0-hybrid 440 ICGLAAGDGSTCGMPPVPGRVRCAMHKGMR 469
                              8***************************** PP

5HRT-like51.81.4e-16495524130
                 HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                              iCG++ ++Gs+C+r+Pv+gR RC+ HKGmR
  mrna11415.1-v1.0-hybrid 495 ICGMTAGNGSICRRPPVPGRVRCAMHKGMR 524
                              8***************************** PP

6HRT-like55.31.1e-17550580131
                 HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                              iCGv+ ++Gs+C+r+Pv+gR RC+ HKGmRi
  mrna11415.1-v1.0-hybrid 550 ICGVTAGNGSICRRPPVPGRVRCAMHKGMRI 580
                              8*****************************7 PP

7HRT-like27.55.2e-09605624120
                 HRT-like   1 iCGviledGsvCkrqPvkgR 20 
                              iCGv+ ++Gs+C+r+Pv+gR
  mrna11415.1-v1.0-hybrid 605 ICGVTAGNGSICRRPPVPGR 624
                              8******************9 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MPVILELEDE APPMVSNVFT LAVQRLKREE CNRTKLDSHQ VIVGPCDWED YSVGKDGAER  60
YRVHNLPEYE SPGVYELAVA VSPSGLGRGI KADQIVPVYV GQADSARTRL QHYGRRGAHL  120
GKSCSVGNGS ELICKGPGLF EEMLARGYTI VYRWAPMRTK NEALRTERKL LDTFDYAWNR  180
NSNASRRRDD VLQKLKKISS KSTRFTATVP RHLPFRQKQV SIRINSSNLI STEKKFSDYA  240
DKESRNLIPQ VIKFGRSQPR LVLDGSGITQ ENTIVCGVAI GDGPICRKAP VQGRKRCAAH  300
KGIKNTGSTT DSNREWVSFE SGITWENTEI CGVAAGDGST CRRPPVQGRK RCAEHKGMRN  360
TESTTASTRE LVTYNSGVTL ENTEICGVAA GDGSICRVPP VPGRVRCAMH KGMRNTGLTT  420
ASNSELVTYK SGNTLENTEI CGLAAGDGST CGMPPVPGRV RCAMHKGMRN TESSTASNIE  480
FFPYISGNTR ENTEICGMTA GNGSICRRPP VPGRVRCAMH KGMRNTESST ASNIEFFSYI  540
SGNTRENTEI CGVTAGNGSI CRRPPVPGRV RCAMHKGMRI TESTTASNRE FVSYSSGNTW  600
DNTDICGVTA GNGSICRRPP VPGRVSAFSN KELDSHDASN VKYESDLVEL PPVHVSESSM  660
SIMWIHLSAD GTPSRK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011459781.10.0PREDICTED: uncharacterized protein LOC101314891 isoform X3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94093139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.19e-79effector of transcription2